Welcome to Bayyess
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Categories
Cart
0
Product Details
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax
HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax

HP Color LaserJet Pro MFP 4301fdw Wireless All-in-One Color Laser Printer, Scanner, Copier, Fax

Product Code: SXcw0gO
Product Condition: New
$734.99 inc. tax
 Add to Cart
Description
  • EVERYTHING SMALL TEAMS NEED – Print, scan and copy professional-quality color documents and reports plus fax. Auto 2-sided printing and auto document feeder for fast scan/copy. Perfect for up to 10 people
  • BLAZING FAST COLOR – Up to 35 color pages per minute, with sharp details and incredible color
  • STAYS CONNECTED – Intelligent Wi-Fi looks for the best connection to stay online and ready to print
  • PROTECTS YOUR DATA – Includes HP Wolf Pro Security with customizable settings so your printer and information are always secure
  • PRINT FROM ANY DEVICE – Wireless printing from any mobile device, PC or tablet. Ethernet and Bluetooth included. Works with Microsoft, Mac, AirPrint, Android, Chromebook and more
  • This printer is intended to work only with cartridges with original HP chips or circuitry and will block cartridges using non-HP chips or circuitry. Periodic firmware updates will maintain the effectiveness of these measures.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i