Welcome to Bayyess
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Categories
Cart
0
Product Details
Sony 1000 M4 Wireless Premium Overhead headphones
Sony 1000 M4 Wireless Premium Overhead headphones
Sony 1000 M4 Wireless Premium Overhead headphones

Sony 1000 M4 Wireless Premium Overhead headphones

Product Code: pj41bjc
Product Condition: New
$288.84 inc. tax
 Add to Cart
Description

Brand Sony
Color Black
Ear Placement Over Ear
Form Factor Over Ear
Impedance 51

  • LONG BATTERY LIFE: Up to 30-hour battery with quick charging (10 min charge for 5 hours of playback)(USB Type-C Cable included)
  • TOUCH SENSOR CONTROLS: Pause play skip tracks, control, activate your voice assistant, and answer phone calls.
  • SPEAK-TO-CHAT: Automatically
  • SUPERIOR CALL QUALITY: Precise voice pick up combines five built-in microphones with advanced audio signal for clear calls
  • MULTIPOINT CONNECTION: Seamless multiple-device pairing
  • ADAPTIVE SOUND CONTROL: Provides a personalized listening experience
  • COMFORT: Updated design relieves pressure for long-lasting comfort
  • EDGE : Co-developed with Sony Music Studios Tokyo, DSEE Extreme (Digital Sound Enhancement Engine) upscales compressed digital music files in real time.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i